PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00120811001
Common NameGSBRNA2T00120811001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 341aa    MW: 38246 Da    PI: 5.9835
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00120811001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.36.4e-32184238155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k r+rWtpeLHe Fveav+qLGG e+A Pk++l++mkv+gLt++hvkSHLQkYR+
  GSBRNA2T00120811001 184 KGRVRWTPELHETFVEAVNQLGGMENAKPKAVLKHMKVQGLTIYHVKSHLQKYRT 238
                          569***************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.087181241IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-30182239IPR009057Homeodomain-like
SuperFamilySSF466891.4E-17183238IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-22184238IPR006447Myb domain, plants
PfamPF002497.9E-11186237IPR001005SANT/Myb domain
PfamPF143794.2E-19270315IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
METRPFRSMS SLALTSSVPN PSVNADISFS SEHNQSMASP YHLLSANGGA VGHNIYSNDL  60
HNHPSVASHI GSSSDTPFIS EILDWDHPDL FDFPLDIPIQ TNQMDDILAE LDEELITDDE  120
NPLMYALLND LFLDTSSTSA ASKVQEPTMQ SQIQQPQVVL HQTSPIVRTV SSNSFTSNNT  180
AAAKGRVRWT PELHETFVEA VNQLGGMENA KPKAVLKHMK VQGLTIYHVK SHLQKYRTAR  240
HVPEPSEAGW REKKLTPVEH VTSLDTKSGM YITEALRIQM EVQKQLHEQL EIQRKMQLQI  300
EKQGKALVMM IEKQNMEFGK PEQEEEAEAD SRRSKRPRKG *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.243481e-141leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00120811001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013675976.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
RefseqXP_013682620.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
TrEMBLA0A078EYV40.0A0A078EYV4_BRANA; BnaC07g00540D protein
STRINGBra036469.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85627117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20400.11e-104G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]